SCOP 1.73: Domain d2adfl2: 2adf L:108-209

Lineage for d2adfl2 (2adf L:108-209)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)

8. Domain d2adfl2: 2adf L:108-209 [126587]
   Other proteins in same PDB: d2adfa1, d2adfh1, d2adfl1
   automatically matched to d1a0ql2
   complexed with acy, gol, so4

Details for d2adfl2

PDB Entry: 2adf, 1.9 Å

PDB Description: Crystal Structure and Paratope Determination of 82D6A3, an Antithrombotic Antibody Directed Against the von Willebrand factor A3-Domain

PDB Compounds: (L:) 82D6A3 IgG

SCOP Domain Sequences for d2adfl2:

Sequence; same for both SEQRES and ATOM records:

>d2adfl2 b.1.1.2 (L:108-209) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfn

Timeline for d2adfl2:

• d2adfl2 is new in SCOP 1.73
  
• d2adfl2 appears in SCOP 1.75
  
• d2adfl2 appears in the current release, SCOPe 2.08