SCOPe 2.02: Domain d2adfl1: 2adf L:2-107

Lineage for d2adfl1 (2adf L:2-107)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (15 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (184 PDB entries)
   Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor

8. Domain d2adfl1: 2adf L:2-107 [126586]
   Other proteins in same PDB: d2adfa_, d2adfh1, d2adfl2
   automatically matched to d1a0ql1
   complexed with acy, gol, so4

Details for d2adfl1

PDB Entry: 2adf, 1.9 Å

PDB Description: Crystal Structure and Paratope Determination of 82D6A3, an Antithrombotic Antibody Directed Against the von Willebrand factor A3-Domain

PDB Compounds: (L:) 82D6A3 IgG

SCOPe Domain Sequences for d2adfl1:

Sequence; same for both SEQRES and ATOM records:

>d2adfl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
iqmtqspsslsaslggkvtitckasqdinkyiawyqhkpgkgprllihytstlqpgipsr
fsgsgsgrdysfsisnlepediatyyclqydnlrtfgggtkleikr

Timeline for d2adfl1:

• d2adfl1 first appeared in SCOP 1.73
  
• d2adfl1 appears in SCOPe 2.01
  
• d2adfl1 appears in SCOPe 2.03
  
• d2adfl1 appears in the current release, SCOPe 2.08