SCOPe 2.08: Domain d2adfh_: 2adf H:

Lineage for d2adfh_ (2adf H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d2adfh_: 2adf H: [126585]
   Other proteins in same PDB: d2adfa_, d2adfl1, d2adfl2
   automated match to d6shgh_
   complexed with acy, gol, so4

Details for d2adfh_

PDB Entry: 2adf, 1.9 Å

PDB Description: Crystal Structure and Paratope Determination of 82D6A3, an Antithrombotic Antibody Directed Against the von Willebrand factor A3-Domain

PDB Compounds: (H:) 82D6A3 IgG

SCOPe Domain Sequences for d2adfh_:

Sequence; same for both SEQRES and ATOM records:

>d2adfh_ b.1.1.0 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qiqlvqsgpelkkpgetvkisckasgytfinygmnwvkqapgkglkwmgwkntntgetty
geefrgrfafsletsvstaylqinnlknedtatyfcardnpyyaldywgqgttvtvssak
ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
tlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Timeline for d2adfh_:

• d2adfh_ first appeared in SCOP 1.73, called d2adfh1
  
• d2adfh_ was called d2adfh1 in SCOPe 2.07