Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.62.1: vWA-like [53300] (6 families) |
Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins) |
Protein automated matches [190060] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186779] (11 PDB entries) |
Domain d2adfa_: 2adf A: [126584] Other proteins in same PDB: d2adfh1, d2adfl1, d2adfl2 automated match to d1fe8c_ complexed with acy, gol, so4 |
PDB Entry: 2adf (more details), 1.9 Å
SCOPe Domain Sequences for d2adfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2adfa_ c.62.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dcsqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidvp wnvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdvs vdsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtlg nsflhklcs
Timeline for d2adfa_: