Lineage for d2adfa_ (2adf A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 999157Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 999158Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 999159Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)
  6. 999290Protein automated matches [190060] (1 species)
    not a true protein
  7. 999291Species Human (Homo sapiens) [TaxId:9606] [186779] (6 PDB entries)
  8. 999300Domain d2adfa_: 2adf A: [126584]
    Other proteins in same PDB: d2adfh1, d2adfl1, d2adfl2
    automated match to d1fe8c_
    complexed with acy, gol, so4

Details for d2adfa_

PDB Entry: 2adf (more details), 1.9 Å

PDB Description: Crystal Structure and Paratope Determination of 82D6A3, an Antithrombotic Antibody Directed Against the von Willebrand factor A3-Domain
PDB Compounds: (A:) von willebrand factor

SCOPe Domain Sequences for d2adfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2adfa_ c.62.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dcsqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidvp
wnvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdvs
vdsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtlg
nsflhklcs

SCOPe Domain Coordinates for d2adfa_:

Click to download the PDB-style file with coordinates for d2adfa_.
(The format of our PDB-style files is described here.)

Timeline for d2adfa_: