Lineage for d2ad7a_ (2ad7 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. Superfamily b.70.1: Quinoprotein alcohol dehydrogenase-like [50998] (2 families) (S)
  5. Family b.70.1.1: Quinoprotein alcohol dehydrogenase-like [50999] (4 proteins)
  6. Protein Methanol dehydrogenase, heavy chain [51000] (3 species)
  7. Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51001] (6 PDB entries)
  8. Domain d2ad7a_: 2ad7 A: [126572]
    Other proteins in same PDB: d2ad7b_, d2ad7d_
    automated match to d1g72a_
    complexed with ca, pqq

Details for d2ad7a_

PDB Entry: 2ad7 (more details), 1.5 Å

PDB Description: crystal structure of methanol dehydrogenase from M. W3A1 (form C) in the presence of methanol
PDB Compounds: (A:) methanol dehydrogenase subunit 1

SCOPe Domain Sequences for d2ad7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ad7a_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
dadldkqvntagawpiatggyysqhnsplaqinksnvknvkaawsfstgvlnghegaplv
igdmmyvhsafpnntyalnlndpgkivwqhkpkqdastkavmccdvvdrglaygagqivk
kqanghllaldaktgkinwevevcdpkvgstltqapfvakdtvlmgcsgaelgvrgavna
fdlktgelkwrafatgsddsvrlakdfnsanphygqfglgtktwegdawkigggtnwgwy
aydpklnlfyygsgnpapwnetmrpgdnkwtmtiwgrdldtgmakwgyqktphdewdfag
vnqmvltdqpvngkmtpllshidrngilytlnrengnlivaekvdpavnvfkkvdlktgt
pvrdpefatrmdhkgtnicpsamgfhnqgvdsydpesrtlyaglnhicmdwepfmlpyra
gqffvgatlamypgpngptkkemgqirafdlttgkakwtkwekfaawggtlytkgglvwy
atldgylkaldnkdgkelwnfkmpsggigspmtysfkgkqyigsmygvggwpgvglvfdl
tdpsaglgavgafrelqnhtqmggglmvfsl

SCOPe Domain Coordinates for d2ad7a_ are not available.

Timeline for d2ad7a_:

Domains from other chains:
(mouse over for more information)
d2ad7b_, d2ad7c_, d2ad7d_