SCOP 1.73: Domain d2acab1: 2aca B:8-181

Lineage for d2acab1 (2aca B:8-181)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
   duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it

4. Superfamily d.63.1: CYTH-like phosphatases [55154] (2 families)

5. Family d.63.1.2: CYTH domain [118007] (3 proteins)
   Pfam PF01928

6. Protein Putative adenylate cyclase VP1760 [143487] (1 species)

7. Species Vibrio parahaemolyticus [TaxId:670] [143488] (1 PDB entry)

8. Domain d2acab1: 2aca B:8-181 [126546]
   automatically matched to 2ACA A:8-181
   complexed with po4

Details for d2acab1

PDB Entry: 2aca, 2.25 Å

PDB Description: X-ray structure of a putative adenylate cyclase Q87NV8 from Vibrio parahaemolyticus at the 2.25 A resolution. Northeast Structural Genomics Target VpR19.

PDB Compounds: (B:) putative adenylate cyclase

SCOP Domain Sequences for d2acab1:

Sequence; same for both SEQRES and ATOM records:

>d2acab1 d.63.1.2 (B:8-181) Putative adenylate cyclase VP1760 {Vibrio parahaemolyticus [TaxId: 670]}
qgqfevelkyrvknhdaflnmvkqiehevmfennqesdwfydtpqrtltqqgkslvlrei
qpagiklwivkgpeadrceatnitkldsaqsmlenmgyeviqcskkirsiffvgefhitl
dfldgfghfaefaimtddetalaryrerlvalaqqfhlseadrehrsykeilsa

Timeline for d2acab1:

• d2acab1 is new in SCOP 1.73
  
• d2acab1 appears in SCOP 1.75
  
• d2acab1 appears in the current release, SCOPe 2.08, called d2acab_