Lineage for d2acaa1 (2aca A:8-181)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726324Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
    duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it
  4. 726325Superfamily d.63.1: CYTH-like phosphatases [55154] (2 families) (S)
  5. 726335Family d.63.1.2: CYTH domain [118007] (3 proteins)
    Pfam PF01928
  6. 726344Protein Putative adenylate cyclase VP1760 [143487] (1 species)
  7. 726345Species Vibrio parahaemolyticus [TaxId:670] [143488] (1 PDB entry)
  8. 726346Domain d2acaa1: 2aca A:8-181 [126545]
    complexed with po4

Details for d2acaa1

PDB Entry: 2aca (more details), 2.25 Å

PDB Description: X-ray structure of a putative adenylate cyclase Q87NV8 from Vibrio parahaemolyticus at the 2.25 A resolution. Northeast Structural Genomics Target VpR19.
PDB Compounds: (A:) putative adenylate cyclase

SCOP Domain Sequences for d2acaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2acaa1 d.63.1.2 (A:8-181) Putative adenylate cyclase VP1760 {Vibrio parahaemolyticus [TaxId: 670]}
qgqfevelkyrvknhdaflnmvkqiehevmfennqesdwfydtpqrtltqqgkslvlrei
qpagiklwivkgpeadrceatnitkldsaqsmlenmgyeviqcskkirsiffvgefhitl
dfldgfghfaefaimtddetalaryrerlvalaqqfhlseadrehrsykeilsa

SCOP Domain Coordinates for d2acaa1:

Click to download the PDB-style file with coordinates for d2acaa1.
(The format of our PDB-style files is described here.)

Timeline for d2acaa1: