Lineage for d2ab6b1 (2ab6 B:85-217)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491601Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1491602Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1491603Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1491803Protein Class mu GST [81348] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [47622] (15 PDB entries)
    Uniprot P09488 P28161
  8. 1491830Domain d2ab6b1: 2ab6 B:85-217 [126509]
    Other proteins in same PDB: d2ab6a2, d2ab6b2, d2ab6c2, d2ab6d2
    automated match to d1xw5a1
    complexed with gsm

Details for d2ab6b1

PDB Entry: 2ab6 (more details), 2.5 Å

PDB Description: human glutathione s-transferase m2-2 (e.c.2.5.1.18) complexed with s- methylglutathione
PDB Compounds: (B:) Glutathione S-transferase Mu 2

SCOPe Domain Sequences for d2ab6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ab6b1 a.45.1.1 (B:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvftkmavwgnk

SCOPe Domain Coordinates for d2ab6b1:

Click to download the PDB-style file with coordinates for d2ab6b1.
(The format of our PDB-style files is described here.)

Timeline for d2ab6b1: