SCOPe 2.05: Domain d2aamf_: 2aam F:

Lineage for d2aamf_ (2aam F:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.15: TM1410-like [141796] (1 protein)
   Pfam PF03537

6. Protein Hypothetical protein TM1410 [141797] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [141798] (1 PDB entry)
   Uniprot Q9X1D0 28-312

8. Domain d2aamf_: 2aam F: [126494]
   automated match to d2aama1
   complexed with gol, unl

Details for d2aamf_

PDB Entry: 2aam, 2.2 Å

PDB Description: Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution

PDB Compounds: (F:) Hypothetical protein TM1410

SCOPe Domain Sequences for d2aamf_:

Sequence; same for both SEQRES and ATOM records:

>d2aamf_ c.1.8.15 (F:) Hypothetical protein TM1410 {Thermotoga maritima [TaxId: 2336]}
tegwfmpfdnwlyqlqnadpveisssgfeiavidyskdgsesgeyspeeikimvdagvvp
vayvnigqaedyrfywkeswytntpewlgeedpawpgnyfvkywynewkeivfsyldrvi
dqgfkgiyldridsfeywaqegvisrrsaarkminfvleiaeyvrerkpdmliipqngen
ildfddgqlastvsgwavenlfylktipleenetksrleylirlnrkgkfilsvdyvddg
sdsfenisrildyyekakrngcipyaarsdleldemnviegiqppe

Timeline for d2aamf_:

• d2aamf_ first appeared in SCOP 1.73, called d2aamf1
  
• d2aamf_ appears in SCOPe 2.04
  
• d2aamf_ appears in SCOPe 2.06
  
• d2aamf_ appears in the current release, SCOPe 2.08