![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.15: TM1410-like [141796] (1 protein) Pfam PF03537 |
![]() | Protein Hypothetical protein TM1410 [141797] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [141798] (1 PDB entry) Uniprot Q9X1D0 28-312 |
![]() | Domain d2aamf_: 2aam F: [126494] automated match to d2aama1 complexed with gol, unl |
PDB Entry: 2aam (more details), 2.2 Å
SCOPe Domain Sequences for d2aamf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aamf_ c.1.8.15 (F:) Hypothetical protein TM1410 {Thermotoga maritima [TaxId: 2336]} tegwfmpfdnwlyqlqnadpveisssgfeiavidyskdgsesgeyspeeikimvdagvvp vayvnigqaedyrfywkeswytntpewlgeedpawpgnyfvkywynewkeivfsyldrvi dqgfkgiyldridsfeywaqegvisrrsaarkminfvleiaeyvrerkpdmliipqngen ildfddgqlastvsgwavenlfylktipleenetksrleylirlnrkgkfilsvdyvddg sdsfenisrildyyekakrngcipyaarsdleldemnviegiqppe
Timeline for d2aamf_: