Lineage for d2aa4a2 (2aa4 A:120-289)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884593Family c.55.1.10: ROK [110636] (8 proteins)
    Pfam PF00480
  6. 2884622Protein N-acetylmannosamine kinase NanK [142471] (1 species)
  7. 2884623Species Escherichia coli [TaxId:562] [142472] (1 PDB entry)
    Uniprot P45425 1-119! Uniprot P45425 120-289
  8. 2884625Domain d2aa4a2: 2aa4 A:120-289 [126466]
    complexed with zn

Details for d2aa4a2

PDB Entry: 2aa4 (more details), 2.2 Å

PDB Description: crystal structure of escherichia coli putative n-acetylmannosamine kinase, new york structural genomics consortium
PDB Compounds: (A:) Putative N-acetylmannosamine kinase

SCOPe Domain Sequences for d2aa4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aa4a2 c.55.1.10 (A:120-289) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]}
ditdmvfitvstgvgggvvsgcklltgpgglaghightladphgpvcgcgrtgcveaias
grgiaaaaqgelagadaktiftragqgdeqaqqlihrsartlarliadikattdcqcvvv
ggsvglaegylalvetylaqepaafhvdllaahyrhdagllgaallaqge

SCOPe Domain Coordinates for d2aa4a2:

Click to download the PDB-style file with coordinates for d2aa4a2.
(The format of our PDB-style files is described here.)

Timeline for d2aa4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aa4a1