SCOPe 2.03: Domain d2aa1a_: 2aa1 A:

Lineage for d2aa1a_ (2aa1 A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (23 species)

7. Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46497] (6 PDB entries)

8. Domain d2aa1a_: 2aa1 A: [126463]
   Other proteins in same PDB: d2aa1b1, d2aa1d_
   automated match to d1la6a_
   complexed with hem

Details for d2aa1a_

PDB Entry: 2aa1, 1.8 Å

PDB Description: Crystal structure of the cathodic hemoglobin isolated from the Antarctic fish Trematomus Newnesi

PDB Compounds: (A:) Hemoglobin alpha-1 chain

SCOPe Domain Sequences for d2aa1a_:

Sequence; same for both SEQRES and ATOM records:

>d2aa1a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}
slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg
kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

Timeline for d2aa1a_:

• d2aa1a_ first appeared in SCOP 1.73, called d2aa1a1
  
• d2aa1a_ appears in SCOPe 2.02
  
• d2aa1a_ appears in SCOPe 2.04
  
• d2aa1a_ appears in the current release, SCOPe 2.08