Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (23 species) |
Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46497] (6 PDB entries) |
Domain d2aa1a_: 2aa1 A: [126463] Other proteins in same PDB: d2aa1b1, d2aa1d_ automated match to d1la6a_ complexed with hem |
PDB Entry: 2aa1 (more details), 1.8 Å
SCOPe Domain Sequences for d2aa1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aa1a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]} slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp eahvsldkflsgvalalaeryr
Timeline for d2aa1a_: