SCOP 1.73: Domain d2aa1a1: 2aa1 A:1-142

Lineage for d2aa1a1 (2aa1 A:1-142)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (19 species)

7. Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46497] (3 PDB entries)

8. Domain d2aa1a1: 2aa1 A:1-142 [126463]
   automatically matched to d1la6a_
   complexed with ace, hem

Details for d2aa1a1

PDB Entry: 2aa1, 1.8 Å

PDB Description: Crystal structure of the cathodic hemoglobin isolated from the Antarctic fish Trematomus Newnesi

PDB Compounds: (A:) Hemoglobin alpha-1 chain

SCOP Domain Sequences for d2aa1a1:

Sequence; same for both SEQRES and ATOM records:

>d2aa1a1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}
slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg
kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

Timeline for d2aa1a1:

• d2aa1a1 is new in SCOP 1.73
  
• d2aa1a1 appears in SCOP 1.75
  
• d2aa1a1 appears in the current release, SCOPe 2.08, called d2aa1a_