SCOPe 2.08: Domain d2a9ya_: 2a9y A:

Lineage for d2a9ya_ (2a9y A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.1: Ribokinase-like [53614] (10 proteins)
   automatically mapped to Pfam PF00294

6. Protein Adenosine kinase [53617] (3 species)

7. Species Toxoplasma gondii [TaxId:5811] [53619] (13 PDB entries)

8. Domain d2a9ya_: 2a9y A: [126460]
   automated match to d2absa1
   complexed with 26a, act, cl, na

Details for d2a9ya_

PDB Entry: 2a9y, 1.35 Å

PDB Description: crystal structure of t. gondii adenosine kinase complexed with n6- dimethyladenosine

PDB Compounds: (A:) adenosine kinase

SCOPe Domain Sequences for d2a9ya_:

Sequence; same for both SEQRES and ATOM records:

>d2a9ya_ c.72.1.1 (A:) Adenosine kinase {Toxoplasma gondii [TaxId: 5811]}
tgpmrvfaignpildlvaevpssfldefflkrgdatlatpeqmriystldqfnptslpgg
salnsvrvvqkllrkpgsagymgaigddprgqvlkelcdkeglatrfmvapgqstgvcav
linekertlcthlgacgsfrlpedwttfasgalifyataytltatpknalevagyahgip
naiftlnlsapfcvelykdamqslllhtnilfgneeefahlakvhnlvaaektalstank
ehavevctgalrlltagqntsatklvvmtrghnpviaaeqtadgtvvvhevgvpvvaaek
ivdtngagdafvggflyalsqgktvkqcimcgnacaqdviqhvgfslsftf

Timeline for d2a9ya_:

• d2a9ya_ first appeared in SCOP 1.73, called d2a9ya1
  
• d2a9ya_ appears in SCOPe 2.07