Lineage for d2a9kb_ (2a9k B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1441943Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 1441944Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 1441945Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 1442000Protein Exoenzyme c3 [56414] (4 species)
  7. 1442008Species Clostridium botulinum [TaxId:1491] [56415] (6 PDB entries)
    Uniprot P15879 41-251
  8. 1442009Domain d2a9kb_: 2a9k B: [126443]
    Other proteins in same PDB: d2a9ka_
    automated match to d1g24a_
    complexed with gdp, mg, nad

Details for d2a9kb_

PDB Entry: 2a9k (more details), 1.73 Å

PDB Description: crystal structure of the c3bot-nad-rala complex reveals a novel type of action of a bacterial exoenzyme
PDB Compounds: (B:) Mono-ADP-ribosyltransferase C3

SCOPe Domain Sequences for d2a9kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a9kb_ d.166.1.1 (B:) Exoenzyme c3 {Clostridium botulinum [TaxId: 1491]}
tyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsnl
ikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfln
kdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprhstyh
iddmrlssdgkqiiitatmmgtainpk

SCOPe Domain Coordinates for d2a9kb_:

Click to download the PDB-style file with coordinates for d2a9kb_.
(The format of our PDB-style files is described here.)

Timeline for d2a9kb_: