Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins) automatically mapped to Pfam PF03414 |
Protein automated matches [190178] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186910] (75 PDB entries) |
Domain d2a8ua2: 2a8u A:64-345 [126420] Other proteins in same PDB: d2a8ua3 automated match to d1lz7a_ complexed with cl, hg, mn, udp |
PDB Entry: 2a8u (more details), 1.69 Å
SCOPe Domain Sequences for d2a8ua2:
Sequence, based on SEQRES records: (download)
>d2a8ua2 c.68.1.9 (A:64-345) automated matches {Human (Homo sapiens) [TaxId: 9606]} vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgaykrwqd vsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssrea ftyerrpqsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwhde shlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavp
>d2a8ua2 c.68.1.9 (A:64-345) automated matches {Human (Homo sapiens) [TaxId: 9606]} vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvleverrflsev dylvcvdvdmefrdhvgveiltplfgtlhpsfygssreaftyerrpqsqayipkdegdfy ymgaffggsvqevqrltrachqammvdqangieavwhdeshlnkyllrhkptkvlspeyl wdqqllgwpavlrklrftavp
Timeline for d2a8ua2: