SCOPe 2.08: Domain d2a8gb_: 2a8g B:

Lineage for d2a8gb_ (2a8g B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries)

8. Domain d2a8gb_: 2a8g B: [126401]
   automated match to d1avda_
   complexed with gng, nag

Details for d2a8gb_

PDB Entry: 2a8g, 1.99 Å

PDB Description: structure of avidin in complex with the ligand deoxyguanosine

PDB Compounds: (B:) Avidin

SCOPe Domain Sequences for d2a8gb_:

Sequence; same for both SEQRES and ATOM records:

>d2a8gb_ b.61.1.1 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
l

Timeline for d2a8gb_:

• d2a8gb_ first appeared in SCOP 1.73, called d2a8gb1
  
• d2a8gb_ appears in SCOPe 2.07