Lineage for d2a83a2 (2a83 A:1-181)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856331Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 856525Species Human (Homo sapiens), HLA-BW44 [TaxId:9606] [102837] (12 PDB entries)
    Uniprot P30481 25-300
  8. 856526Domain d2a83a2: 2a83 A:1-181 [126387]
    Other proteins in same PDB: d2a83a1, d2a83b1
    automatically matched to d1m6oa2
    complexed with gol, na

Details for d2a83a2

PDB Entry: 2a83 (more details), 1.4 Å

PDB Description: crystal structure of hla-b*2705 complexed with the glucagon receptor (gr) peptide (residues 412-420)
PDB Compounds: (A:) HLA class I histocompatibility antigen, B-27 alpha chain

SCOP Domain Sequences for d2a83a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a83a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-BW44 [TaxId: 9606]}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqdaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r

SCOP Domain Coordinates for d2a83a2:

Click to download the PDB-style file with coordinates for d2a83a2.
(The format of our PDB-style files is described here.)

Timeline for d2a83a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a83a1
View in 3D
Domains from other chains:
(mouse over for more information)
d2a83b1