SCOPe 2.08: Domain d2a7tb_: 2a7t B:

Lineage for d2a7tb_ (2a7t B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.7: Scorpion toxin-like [57095] (6 families)

5. Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins)

6. Protein Scorpion toxin [57097] (17 species)

7. Species Indian red scorpion (Buthus tamulus), neurotoxin [TaxId:34647] [57109] (2 PDB entries)

8. Domain d2a7tb_: 2a7t B: [126366]
   automated match to d1dq7a_

Details for d2a7tb_

PDB Entry: 2a7t, 2.2 Å

PDB Description: Crystal Structure of a novel neurotoxin from Buthus tamalus at 2.2A resolution.

PDB Compounds: (B:) Neurotoxin

SCOPe Domain Sequences for d2a7tb_:

Sequence; same for both SEQRES and ATOM records:

>d2a7tb_ g.3.7.1 (B:) Scorpion toxin {Indian red scorpion (Buthus tamulus), neurotoxin [TaxId: 34647]}
gedgyiadgdnctyictfnnychalctdkkgdsgacdwwvpygvvcwcedlptpvpirgs
gkcr

Timeline for d2a7tb_:

• d2a7tb_ first appeared in SCOP 1.73, called d2a7tb1
  
• d2a7tb_ appears in SCOPe 2.07