SCOPe 2.08: Domain d2a7aa_: 2a7a A:

Lineage for d2a7aa_ (2a7a A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Concanavalin A [49901] (4 species)
   natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop

7. Species Canavalia virosa [TaxId:28958] [186936] (3 PDB entries)

8. Domain d2a7aa_: 2a7a A: [126332]
   automated match to d1apna_
   complexed with ca, mn, xe

Details for d2a7aa_

PDB Entry: 2a7a, 1.75 Å

PDB Description: On the Routine Use of Soft X-Rays in Macromolecular Crystallography, Part III- The Optimal Data Collection Wavelength

PDB Compounds: (A:) concanavalin a

SCOPe Domain Sequences for d2a7aa_:

Sequence; same for both SEQRES and ATOM records:

>d2a7aa_ b.29.1.1 (A:) Concanavalin A {Canavalia virosa [TaxId: 28958]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Timeline for d2a7aa_:

• d2a7aa_ first appeared in SCOP 1.73, called d2a7aa1
  
• d2a7aa_ appears in SCOPe 2.07