SCOPe 2.01: Domain d2a78a_: 2a78 A:

Lineage for d2a78a_ (2a78 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ras-related protein RalA [89662] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89663] (5 PDB entries)

8. Domain d2a78a_: 2a78 A: [126329]
   Other proteins in same PDB: d2a78b_
   automated match to d1uada_
   complexed with gdp, mg

Details for d2a78a_

PDB Entry: 2a78, 1.81 Å

PDB Description: crystal structure of the c3bot-rala complex reveals a novel type of action of a bacterial exoenzyme

PDB Compounds: (A:) Ras-related protein Ral-A

SCOPe Domain Sequences for d2a78a_:

Sequence; same for both SEQRES and ATOM records:

>d2a78a_ c.37.1.8 (A:) Ras-related protein RalA {Human (Homo sapiens) [TaxId: 9606]}
alhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildtagq
edyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksdle
dkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmed

Timeline for d2a78a_:

• d2a78a_ first appeared in SCOP 1.73, called d2a78a1
  
• d2a78a_ was called d2a78a1 in SCOP 1.75
  
• d2a78a_ appears in SCOPe 2.02
  
• d2a78a_ appears in the current release, SCOPe 2.08