SCOP 1.73: Domain d2a77h1: 2a77 H:123-223

Lineage for d2a77h1 (2a77 H:123-223)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d2a77h1: 2a77 H:123-223 [126328]
   automatically matched to d1mfbh2
   complexed with gol, so4

Details for d2a77h1

PDB Entry: 2a77, 1.8 Å

PDB Description: anti-cocaine antibody 7.5.21, crystal form ii

PDB Compounds: (H:) immunoglobulin heavy chain

SCOP Domain Sequences for d2a77h1:

Sequence; same for both SEQRES and ATOM records:

>d2a77h1 b.1.1.2 (H:123-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Timeline for d2a77h1:

• d2a77h1 is new in SCOP 1.73
  
• d2a77h1 appears in SCOP 1.75
  
• d2a77h1 appears in the current release, SCOPe 2.08, called d2a77h_