SCOP 1.73: Domain d2a6ib1: 2a6i B:111-219

Lineage for d2a6ib1 (2a6i B:111-219)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d2a6ib1: 2a6i B:111-219 [126280]
   automatically matched to d1ck0h2

Details for d2a6ib1

PDB Entry: 2a6i, 2.5 Å

PDB Description: crystal structure analysis of the anti-arsonate germline antibody 36- 65 in complex with a phage display derived dodecapeptide klasipthtspl

PDB Compounds: (B:) Germline antibody 36-65 Fab heavy chain

SCOP Domain Sequences for d2a6ib1:

Sequence, based on SEQRES records:

>d2a6ib1 b.1.1.2 (B:111-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
wgqgttltvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssg
vhtfpavlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkiv

Sequence, based on observed residues (ATOM records):

>d2a6ib1 b.1.1.2 (B:111-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
wgqgttltvssakttppsvyplapgsansmvtlgclvkgyfpepvtvtwnsgslssgvht
fpavlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkiv

Timeline for d2a6ib1:

• d2a6ib1 is new in SCOP 1.73
  
• d2a6ib1 appears in SCOP 1.75
  
• d2a6ib1 last appears in SCOPe 2.04