SCOPe 2.08: Domain d2a6hl1: 2a6h L:1-49,L:173-229

Lineage for d2a6hl1 (2a6h L:1-49,L:173-229)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins)

6. Protein RNA polymerase alpha [55259] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75478] (16 PDB entries)
   Uniprot Q9Z9H6; part of multichain biological unit

8. Domain d2a6hl1: 2a6h L:1-49,L:173-229 [126272]
   Other proteins in same PDB: d2a6ha2, d2a6hb2, d2a6hc_, d2a6hd_, d2a6he_, d2a6hf1, d2a6hf2, d2a6hf3, d2a6hk2, d2a6hl2, d2a6hm_, d2a6hn_, d2a6ho_, d2a6hp1, d2a6hp2, d2a6hp3
   automated match to d1smya1
   protein/RNA complex; complexed with mg, std, zn

Details for d2a6hl1

PDB Entry: 2a6h, 2.4 Å

PDB Description: Crystal structure of the T. thermophilus RNA polymerase holoenzyme in complex with antibiotic sterptolydigin

PDB Compounds: (L:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d2a6hl1:

Sequence; same for both SEQRES and ATOM records:

>d2a6hl1 d.74.3.1 (L:1-49,L:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq

Timeline for d2a6hl1:

• d2a6hl1 first appeared in SCOP 1.73
  
• d2a6hl1 appears in SCOPe 2.07