SCOP 1.73: Domain d2a6el2: 2a6e L:50-172

Lineage for d2a6el2 (2a6e L:50-172)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
   unusual fold; contains a left-handed beta-alpha-beta unit

4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)

5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)

6. Protein RNA polymerase alpha subunit [56555] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75595] (9 PDB entries)

8. Domain d2a6el2: 2a6e L:50-172 [126253]
   Other proteins in same PDB: d2a6ea1, d2a6eb1, d2a6ec1, d2a6ed1, d2a6ee1, d2a6ef1, d2a6ef2, d2a6ef3, d2a6ek1, d2a6el1, d2a6em1, d2a6en1, d2a6eo1, d2a6ep1, d2a6ep2, d2a6ep3
   automatically matched to d1iw7a2
   complexed with mg, zn

Details for d2a6el2

PDB Entry: 2a6e, 2.8 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme

PDB Compounds: (L:) DNA-directed RNA polymerase alpha chain

SCOP Domain Sequences for d2a6el2:

Sequence; same for both SEQRES and ATOM records:

>d2a6el2 d.181.1.1 (L:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

Timeline for d2a6el2:

• d2a6el2 is new in SCOP 1.73
  
• d2a6el2 appears in SCOP 1.75
  
• d2a6el2 appears in the current release, SCOPe 2.08