SCOP 1.75: Domain d2a6cb1: 2a6c B:1-69

Lineage for d2a6cb1 (2a6c B:1-69)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families)

5. Family a.35.1.13: NE1354 [140532] (2 proteins)
   contains extra C-terminal dimerisation arm (beta-strand)

6. Protein HTH-motif protein NE1354 [140533] (1 species)

7. Species Nitrosomonas europaea [TaxId:915] [140534] (1 PDB entry)
   Uniprot Q82UW4 1-69

8. Domain d2a6cb1: 2a6c B:1-69 [126237]
   automatically matched to 2A6C A:1-69
   complexed with cit, edo, gol

Details for d2a6cb1

PDB Entry: 2a6c, 1.9 Å

PDB Description: crystal structure of a putative transcriptional regulator (ne_1354) from nitrosomonas europaea at 1.90 a resolution

PDB Compounds: (B:) Helix-turn-helix motif

SCOP Domain Sequences for d2a6cb1:

Sequence; same for both SEQRES and ATOM records:

>d2a6cb1 a.35.1.13 (B:1-69) HTH-motif protein NE1354 {Nitrosomonas europaea [TaxId: 915]}
mkmrsqllivlqehlrnsgltqfkaaellgvtqprvsdlmrgkidlfsleslidmitsig
lkveinikd

Timeline for d2a6cb1:

• d2a6cb1 first appeared in SCOP 1.73
  
• d2a6cb1 is called d2a6cb_ in SCOPe 2.01
  
• d2a6cb1 appears in the current release, SCOPe 2.08, called d2a6cb2