Lineage for d2a61c1 (2a61 C:5-143)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 762443Family a.4.5.28: MarR-like transcriptional regulators [63379] (19 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 762534Protein Transcriptional regulator TM0710 [140253] (1 species)
  7. 762535Species Thermotoga maritima [TaxId:2336] [140254] (1 PDB entry)
    Uniprot Q9WZG9 5-143
  8. 762538Domain d2a61c1: 2a61 C:5-143 [126189]
    automatically matched to 2A61 A:5-143

Details for d2a61c1

PDB Entry: 2a61 (more details), 1.8 Å

PDB Description: The crystal structure of transcriptional regulator Tm0710 from Thermotoga maritima
PDB Compounds: (C:) transcriptional regulator Tm0710

SCOP Domain Sequences for d2a61c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a61c1 a.4.5.28 (C:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]}
kqpferilreicfmvkvegrkvlrdfgitpaqfdilqkiyfegpkrpgelsvllgvakst
vtglvkrleadgyltrtpdpadrrayflvitrkgeeviekvierrenfiekitsdlgkek
sskildylkelkgvmernf

SCOP Domain Coordinates for d2a61c1:

Click to download the PDB-style file with coordinates for d2a61c1.
(The format of our PDB-style files is described here.)

Timeline for d2a61c1: