Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) contains a small beta-sheet (wing) |
Family a.4.5.28: MarR-like transcriptional regulators [63379] (19 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
Protein Transcriptional regulator TM0710 [140253] (1 species) |
Species Thermotoga maritima [TaxId:2336] [140254] (1 PDB entry) Uniprot Q9WZG9 5-143 |
Domain d2a61c1: 2a61 C:5-143 [126189] automatically matched to 2A61 A:5-143 |
PDB Entry: 2a61 (more details), 1.8 Å
SCOP Domain Sequences for d2a61c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a61c1 a.4.5.28 (C:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} kqpferilreicfmvkvegrkvlrdfgitpaqfdilqkiyfegpkrpgelsvllgvakst vtglvkrleadgyltrtpdpadrrayflvitrkgeeviekvierrenfiekitsdlgkek sskildylkelkgvmernf
Timeline for d2a61c1: