Lineage for d2a5tb1 (2a5t B:7-142,B:145-284)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 846191Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 846192Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 846193Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)
  6. 846630Protein N-methyl-D-aspartate receptor subunit 1 [89787] (2 species)
  7. 846642Species Rat (Rattus norvegicus), subtype 2A [TaxId:10116] [142803] (2 PDB entries)
    Uniprot Q00959 404-539,661-801
  8. 846644Domain d2a5tb1: 2a5t B:7-142,B:145-284 [126180]
    automatically matched to 2A5S A:7-142,A:145-285
    complexed with glu, gly

Details for d2a5tb1

PDB Entry: 2a5t (more details), 2 Å

PDB Description: crystal structure of the nr1/nr2a ligand-binding cores complex
PDB Compounds: (B:) N-methyl-D-aspartate receptor NMDAR2A subunit

SCOP Domain Sequences for d2a5tb1:

Sequence, based on SEQRES records: (download)

>d2a5tb1 c.94.1.1 (B:7-142,B:145-284) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]}
nhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfcidi
lkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvd
fsvpfvetgisvmvsrXqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymhq
ymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgygi
alqkgspwkrqidlallqfvgdgemeeletlwltgic

Sequence, based on observed residues (ATOM records): (download)

>d2a5tb1 c.94.1.1 (B:7-142,B:145-284) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]}
nhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfcidi
lkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvd
fsvpfvetgisvmvsrXqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymhq
ymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigyifattgygial
qkgspwkrqidlallqfvgdgemeeletlwltgic

SCOP Domain Coordinates for d2a5tb1:

Click to download the PDB-style file with coordinates for d2a5tb1.
(The format of our PDB-style files is described here.)

Timeline for d2a5tb1: