Lineage for d2a5ga1 (2a5g A:12-173)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2474876Protein ADP-ribosylation factor [52614] (16 species)
  7. 2474914Species Human (Homo sapiens), ARF6 [TaxId:9606] [52617] (5 PDB entries)
  8. 2474917Domain d2a5ga1: 2a5g A:12-173 [126174]
    Other proteins in same PDB: d2a5gb_
    complexed with gtp, mg, na

Details for d2a5ga1

PDB Entry: 2a5g (more details), 2.66 Å

PDB Description: cholera toxin a1 subunit bound to arf6(q67l)
PDB Compounds: (A:) ADP-ribosylation factor 6

SCOPe Domain Sequences for d2a5ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a5ga1 c.37.1.8 (A:12-173) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]}
kemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldkir
plwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamk
pheiqeklgltrirdrnwyvqpscatsgdglyegltwltsny

SCOPe Domain Coordinates for d2a5ga1:

Click to download the PDB-style file with coordinates for d2a5ga1.
(The format of our PDB-style files is described here.)

Timeline for d2a5ga1: