SCOPe 2.08: Domain d2a5ba_: 2a5b A:

Lineage for d2a5ba_ (2a5b A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries)

8. Domain d2a5ba_: 2a5b A: [126168]
   automated match to d1avdb_
   protein/DNA complex; complexed with 8hg, nag

Details for d2a5ba_

PDB Entry: 2a5b, 2.49 Å

PDB Description: avidin complexed with 8-oxodeoxyguanosine

PDB Compounds: (A:) Avidin

SCOPe Domain Sequences for d2a5ba_:

Sequence; same for both SEQRES and ATOM records:

>d2a5ba_ b.61.1.1 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
trlr

Timeline for d2a5ba_:

• d2a5ba_ first appeared in SCOP 1.73, called d2a5ba1
  
• d2a5ba_ appears in SCOPe 2.07