Lineage for d2a4da1 (2a4d A:82-220)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1642804Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1642805Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1642806Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1642814Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1642874Species Human (Homo sapiens), E2 variant 1 [TaxId:9606] [143051] (3 PDB entries)
    Uniprot Q13404 80-221! Uniprot Q13404 82-220
  8. 1642875Domain d2a4da1: 2a4d A:82-220 [126152]

Details for d2a4da1

PDB Entry: 2a4d (more details), 1.69 Å

PDB Description: Structure of the human ubiquitin-conjugating enzyme E2 variant 1 (UEV-1)
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 variant 1

SCOPe Domain Sequences for d2a4da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]}
gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtiyenriysl
kiecgpkypeappfvrfvtkinmngvnssngvvdpraisvlakwqnsysikvvlqelrrl
mmskenmklpqppegqcys

SCOPe Domain Coordinates for d2a4da1:

Click to download the PDB-style file with coordinates for d2a4da1.
(The format of our PDB-style files is described here.)

Timeline for d2a4da1: