Lineage for d2a4da1 (2a4d A:82-220)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720005Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 720006Superfamily d.20.1: UBC-like [54495] (4 families) (S)
  5. 720007Family d.20.1.1: UBC-related [54496] (6 proteins)
  6. 720015Protein Ubiquitin conjugating enzyme, UBC [54497] (31 species)
  7. 720066Species Human (Homo sapiens), E2 variant 1 [TaxId:9606] [143051] (2 PDB entries)
  8. 720067Domain d2a4da1: 2a4d A:82-220 [126152]

Details for d2a4da1

PDB Entry: 2a4d (more details), 1.69 Å

PDB Description: Structure of the human ubiquitin-conjugating enzyme E2 variant 1 (UEV-1)
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 variant 1

SCOP Domain Sequences for d2a4da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]}
gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtiyenriysl
kiecgpkypeappfvrfvtkinmngvnssngvvdpraisvlakwqnsysikvvlqelrrl
mmskenmklpqppegqcys

SCOP Domain Coordinates for d2a4da1:

Click to download the PDB-style file with coordinates for d2a4da1.
(The format of our PDB-style files is described here.)

Timeline for d2a4da1: