SCOPe 2.04: Domain d2a3ua_: 2a3u A:

Lineage for d2a3ua_ (2a3u A:)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Klebsiella pneumoniae, SHV-1 [TaxId:573] [56609] (23 PDB entries)
   inhibited by tazobactam
   Uniprot Q5PSW7 ! Uniprot P14557 22-286

8. Domain d2a3ua_: 2a3u A: [126098]
   automated match to d1onga_
   complexed with epe, ma4, tsl

Details for d2a3ua_

PDB Entry: 2a3u, 1.34 Å

PDB Description: crystal structure of sulbactam bound to e166a variant of shv-1 beta- lactamase

PDB Compounds: (A:) Beta-lactamase SHV-1

SCOPe Domain Sequences for d2a3ua_:

Sequence; same for both SEQRES and ATOM records:

>d2a3ua_ e.3.1.1 (A:) beta-Lactamase, class A {Klebsiella pneumoniae, SHV-1 [TaxId: 573]}
spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmstfkvvlcgavlarvd
agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmsdnsaanlllatvggp
agltaflrqigdnvtrldrwatelnealpgdardtttpasmaatlrklltsqrlsarsqr
qllqwmvddrvagplirsvlpagwfiadktgagergargivallgpnnkaerivviylrd
tpasmaernqqiagigaaliehwqr

Timeline for d2a3ua_:

• d2a3ua_ first appeared in SCOP 1.73, called d2a3ua1
  
• d2a3ua_ appears in SCOPe 2.03
  
• d2a3ua_ appears in SCOPe 2.05
  
• d2a3ua_ appears in the current release, SCOPe 2.08