Lineage for d2a3ea2 (2a3e A:299-360)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720425Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 720612Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 720613Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 720614Protein Chitinase 1 [54562] (2 species)
  7. 720615Species Aspergillus fumigatus [TaxId:5085] [117868] (9 PDB entries)
  8. 720622Domain d2a3ea2: 2a3e A:299-360 [126087]
    Other proteins in same PDB: d2a3ea1, d2a3eb1
    automatically matched to 1W9V A:299-360
    complexed with ami, naa, so4

Details for d2a3ea2

PDB Entry: 2a3e (more details), 1.95 Å

PDB Description: Crystal structure of Aspergillus fumigatus chitinase B1 in complex with allosamidin
PDB Compounds: (A:) chitinase

SCOP Domain Sequences for d2a3ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a3ea2 d.26.3.1 (A:299-360) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]}
ygrsfantdgpgkpyngvgqgswengvwdykalpqagatehvlpdimasysydatnkfli
sy

SCOP Domain Coordinates for d2a3ea2:

Click to download the PDB-style file with coordinates for d2a3ea2.
(The format of our PDB-style files is described here.)

Timeline for d2a3ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a3ea1