Lineage for d2a3ca1 (2a3c A:39-298,A:361-433)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2831708Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 2831709Protein Chitinase 1 [51548] (2 species)
  7. 2831710Species Aspergillus fumigatus [TaxId:5085] [117368] (14 PDB entries)
    Uniprot Q873X9
  8. 2831725Domain d2a3ca1: 2a3c A:39-298,A:361-433 [126082]
    Other proteins in same PDB: d2a3ca2, d2a3cb2
    automated match to d1w9pa1
    complexed with pnx, so4

Details for d2a3ca1

PDB Entry: 2a3c (more details), 2.07 Å

PDB Description: Crystal structure of Aspergillus fumigatus chitinase B1 in complex with pentoxifylline
PDB Compounds: (A:) chitinase

SCOPe Domain Sequences for d2a3ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a3ca1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]}
assgyrsvvyfvnwaiygrnhnpqdlpverlthvlyafanvrpetgevymtdswadiekh
ypgdswsdtgnnvygcikqlyllkkqnrnlkvllsiggwtyspnfapaastdagrknfak
tavkllqdlgfdgldidweypendqqandfvlllkevrtaldsysaanaggqhflltvas
pagpdkikvlhlkdmdqqldfwnlmaydyagsfsslsghqanvyndtsnplstpfntqta
ldlyraggvpankivlgmplXdnpqvanlksgyikslglggamwwdsssdktgsdslitt
vvnalggtgvfeqsqneldypvsqydnlrngmqt

SCOPe Domain Coordinates for d2a3ca1:

Click to download the PDB-style file with coordinates for d2a3ca1.
(The format of our PDB-style files is described here.)

Timeline for d2a3ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a3ca2