Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
Species Human (Homo sapiens) [TaxId:9606] [49268] (34 PDB entries) Uniprot P13726 33-242 |
Domain d2a2qt2: 2a2q T:107-210 [126057] Other proteins in same PDB: d2a2qh_, d2a2ql1, d2a2ql2, d2a2ql3 automated match to d1uj3c2 complexed with ca, cl, fuc, glc, mg, na, pbz, zn |
PDB Entry: 2a2q (more details), 1.8 Å
SCOPe Domain Sequences for d2a2qt2:
Sequence, based on SEQRES records: (download)
>d2a2qt2 b.1.2.1 (T:107-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecm
>d2a2qt2 b.1.2.1 (T:107-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywktaktntn eflidvdkgenycfsvqavipsrtvnrkstdspvecm
Timeline for d2a2qt2:
View in 3D Domains from other chains: (mouse over for more information) d2a2qh_, d2a2ql1, d2a2ql2, d2a2ql3 |