Lineage for d2a2qt1 (2a2q T:6-106)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2035676Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2035677Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2035780Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 2035781Species Human (Homo sapiens) [TaxId:9606] [49268] (34 PDB entries)
    Uniprot P13726 33-242
  8. 2035789Domain d2a2qt1: 2a2q T:6-106 [126056]
    Other proteins in same PDB: d2a2qh_, d2a2ql1, d2a2ql2, d2a2ql3
    automated match to d1uj3c1
    complexed with ca, cl, fuc, glc, mg, na, pbz, zn

Details for d2a2qt1

PDB Entry: 2a2q (more details), 1.8 Å

PDB Description: complex of active-site inhibited human coagulation factor viia with human soluble tissue factor in the presence of ca2+, mg2+, na+, and zn2+
PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d2a2qt1:

Sequence, based on SEQRES records: (download)

>d2a2qt1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpylet

Sequence, based on observed residues (ATOM records): (download)

>d2a2qt1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagngeplyenspeftpylet

SCOPe Domain Coordinates for d2a2qt1:

Click to download the PDB-style file with coordinates for d2a2qt1.
(The format of our PDB-style files is described here.)

Timeline for d2a2qt1: