Lineage for d2a2qt1 (2a2q T:6-108)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 787437Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 787438Family b.1.2.1: Fibronectin type III [49266] (44 proteins)
    Pfam PF00041
  6. 787537Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 787566Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (18 PDB entries)
  8. 787567Domain d2a2qt1: 2a2q T:6-108 [126056]
    Other proteins in same PDB: d2a2qh1, d2a2ql1, d2a2ql2, d2a2ql3
    automatically matched to d1a21a1
    complexed with ca, cl, fuc, glc, mg, na, pbz, zn

Details for d2a2qt1

PDB Entry: 2a2q (more details), 1.8 Å

PDB Description: complex of active-site inhibited human coagulation factor viia with human soluble tissue factor in the presence of ca2+, mg2+, na+, and zn2+
PDB Compounds: (T:) tissue factor

SCOP Domain Sequences for d2a2qt1:

Sequence, based on SEQRES records: (download)

>d2a2qt1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpyletnl

Sequence, based on observed residues (ATOM records): (download)

>d2a2qt1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagngeplyenspeftpyletnl

SCOP Domain Coordinates for d2a2qt1:

Click to download the PDB-style file with coordinates for d2a2qt1.
(The format of our PDB-style files is described here.)

Timeline for d2a2qt1: