Lineage for d2a2ql2 (2a2q L:91-140)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 747016Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 747704Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 747705Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 747785Protein Factor IX (IXa) [57198] (2 species)
  7. 747791Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries)
  8. 747795Domain d2a2ql2: 2a2q L:91-140 [126054]
    Other proteins in same PDB: d2a2qh1, d2a2ql3, d2a2qt1, d2a2qt2
    automatically matched to d1pfxl2
    complexed with ca, cl, fuc, glc, mg, na, pbz, zn

Details for d2a2ql2

PDB Entry: 2a2q (more details), 1.8 Å

PDB Description: complex of active-site inhibited human coagulation factor viia with human soluble tissue factor in the presence of ca2+, mg2+, na+, and zn2+
PDB Compounds: (L:) Coagulation factor VII

SCOP Domain Sequences for d2a2ql2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a2ql2 g.3.11.1 (L:91-140) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}
cvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipi

SCOP Domain Coordinates for d2a2ql2:

Click to download the PDB-style file with coordinates for d2a2ql2.
(The format of our PDB-style files is described here.)

Timeline for d2a2ql2: