Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
Protein automated matches [190312] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224883] (13 PDB entries) |
Domain d2a1tr2: 2a1t R:209-333 [126014] Other proteins in same PDB: d2a1ta1, d2a1ta2, d2a1tb1, d2a1tb2, d2a1tc1, d2a1tc2, d2a1td1, d2a1td2, d2a1tr1, d2a1ts1 automated match to d1efva2 complexed with amp, fad |
PDB Entry: 2a1t (more details), 2.8 Å
SCOPe Domain Sequences for d2a1tr2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a1tr2 c.31.1.0 (R:209-333) automated matches {Human (Homo sapiens) [TaxId: 9606]} rpeltgakvvvsggrglksgenfkllydladqlhaavgasraavdagfvpndmqvgqtgk ivapelyiavgisgaiqhlagmkdsktivainkdpeapifqvadygivadlfkvvpemte ilkkk
Timeline for d2a1tr2: