SCOPe 2.04: Domain d2a1tr2: 2a1t R:209-333

Lineage for d2a1tr2 (2a1t R:209-333)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.0: automated matches [191352] (1 protein)
   not a true family

6. Protein automated matches [190312] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224883] (13 PDB entries)

8. Domain d2a1tr2: 2a1t R:209-333 [126014]
   Other proteins in same PDB: d2a1ta1, d2a1ta2, d2a1tb1, d2a1tb2, d2a1tc1, d2a1tc2, d2a1td1, d2a1td2, d2a1tr1, d2a1ts1
   automated match to d1efva2
   complexed with amp, fad

Details for d2a1tr2

PDB Entry: 2a1t, 2.8 Å

PDB Description: structure of the human mcad:etf e165betaa complex

PDB Compounds: (R:) Electron transfer flavoprotein alpha-subunit, mitochondrial precursor

SCOPe Domain Sequences for d2a1tr2:

Sequence; same for both SEQRES and ATOM records:

>d2a1tr2 c.31.1.0 (R:209-333) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpeltgakvvvsggrglksgenfkllydladqlhaavgasraavdagfvpndmqvgqtgk
ivapelyiavgisgaiqhlagmkdsktivainkdpeapifqvadygivadlfkvvpemte
ilkkk

Timeline for d2a1tr2:

• d2a1tr2 first appeared in SCOP 1.73
  
• d2a1tr2 appears in SCOPe 2.03
  
• d2a1tr2 appears in SCOPe 2.05
  
• d2a1tr2 appears in the current release, SCOPe 2.08