Class a: All alpha proteins [46456] (285 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
Protein automated matches [226935] (18 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225243] (4 PDB entries) |
Domain d2a1td1: 2a1t D:242-396 [126011] Other proteins in same PDB: d2a1ta2, d2a1tb2, d2a1tc2, d2a1td2, d2a1tr1, d2a1tr2, d2a1ts1 automated match to d1egda1 complexed with amp, fad |
PDB Entry: 2a1t (more details), 2.8 Å
SCOPe Domain Sequences for d2a1td1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a1td1 a.29.3.0 (D:242-396) automated matches {Human (Homo sapiens) [TaxId: 9606]} gagfkvamgafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaem amkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteyp veklmrdakiyqiyegtsqiqrlivarehidkykn
Timeline for d2a1td1: