Lineage for d2a1tc2 (2a1t C:9-241)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1950935Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1950936Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1950937Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)
  6. 1951027Protein automated matches [226961] (2 species)
    not a true protein
  7. 1951057Species Human (Homo sapiens) [TaxId:9606] [225392] (3 PDB entries)
  8. 1951069Domain d2a1tc2: 2a1t C:9-241 [126010]
    Other proteins in same PDB: d2a1ta1, d2a1tb1, d2a1tc1, d2a1td1, d2a1tr1, d2a1tr2, d2a1ts1
    automated match to d1egda2
    complexed with amp, fad

Details for d2a1tc2

PDB Entry: 2a1t (more details), 2.8 Å

PDB Description: structure of the human mcad:etf e165betaa complex
PDB Compounds: (C:) Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursor

SCOPe Domain Sequences for d2a1tc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a1tc2 e.6.1.1 (C:9-241) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipe
ncgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteep
lmcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpka
pankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligd

SCOPe Domain Coordinates for d2a1tc2:

Click to download the PDB-style file with coordinates for d2a1tc2.
(The format of our PDB-style files is described here.)

Timeline for d2a1tc2: