Lineage for d2a1eb1 (2a1e B:1-99)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 671907Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 671908Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 671909Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 671925Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 671926Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (230 PDB entries)
  8. 671962Domain d2a1eb1: 2a1e B:1-99 [125990]
    automatically matched to d1fgcc_
    complexed with act, cl, dms, gol, ipf, na; mutant

Details for d2a1eb1

PDB Entry: 2a1e (more details), 1.3 Å

PDB Description: high resolution structure of hiv-1 pr with ts-126
PDB Compounds: (B:) Pol polyprotein

SCOP Domain Sequences for d2a1eb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a1eb1 b.50.1.1 (B:1-99) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

SCOP Domain Coordinates for d2a1eb1:

Click to download the PDB-style file with coordinates for d2a1eb1.
(The format of our PDB-style files is described here.)

Timeline for d2a1eb1: