Lineage for d2a07k_ (2a07 K:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1260111Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1260112Protein automated matches [190154] (41 species)
    not a true protein
  7. 1260202Species Human (Homo sapiens) [TaxId:9606] [186924] (7 PDB entries)
  8. 1260212Domain d2a07k_: 2a07 K: [125943]
    Other proteins in same PDB: d2a07f1
    automated match to d1d5va_
    protein/DNA complex; complexed with mg

Details for d2a07k_

PDB Entry: 2a07 (more details), 1.9 Å

PDB Description: crystal structure of foxp2 bound specifically to dna.
PDB Compounds: (K:) Forkhead box protein P2

SCOPe Domain Sequences for d2a07k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a07k_ a.4.5.0 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivrppftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkc
fvrvenvkgavwtvdeveyqkrr

SCOPe Domain Coordinates for d2a07k_:

Click to download the PDB-style file with coordinates for d2a07k_.
(The format of our PDB-style files is described here.)

Timeline for d2a07k_: