Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186924] (29 PDB entries) |
Domain d2a07k_: 2a07 K: [125943] Other proteins in same PDB: d2a07f1 automated match to d1d5va_ protein/DNA complex; complexed with mg |
PDB Entry: 2a07 (more details), 1.9 Å
SCOPe Domain Sequences for d2a07k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a07k_ a.4.5.0 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ivrppftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkc fvrvenvkgavwtvdeveyqkrr
Timeline for d2a07k_: