SCOPe 2.01: Domain d2a07j_: 2a07 J:

Lineage for d2a07j_ (2a07 J:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186924] (2 PDB entries)

8. Domain d2a07j_: 2a07 J: [125942]
   Other proteins in same PDB: d2a07f1
   automated match to d1d5va_
   protein/DNA complex; complexed with mg

Details for d2a07j_

PDB Entry: 2a07, 1.9 Å

PDB Description: crystal structure of foxp2 bound specifically to dna.

PDB Compounds: (J:) Forkhead box protein P2

SCOPe Domain Sequences for d2a07j_:

Sequence; same for both SEQRES and ATOM records:

>d2a07j_ a.4.5.0 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivrppftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkc
fvrvenvkgavwtvdeveyqkrr

Timeline for d2a07j_:

• d2a07j_ first appeared in SCOP 1.73, called d2a07j1
  
• d2a07j_ was called d2a07j1 in SCOP 1.75
  
• d2a07j_ appears in SCOPe 2.02
  
• d2a07j_ appears in the current release, SCOPe 2.08