Lineage for d2a07h1 (2a07 H:506-584)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 762145Family a.4.5.14: Forkhead DNA-binding domain [46832] (6 proteins)
  6. 762153Protein Forkhead box protein P2, FOXP2 [140265] (1 species)
  7. 762154Species Human (Homo sapiens) [TaxId:9606] [140266] (2 PDB entries)
    Uniprot O15409 503-584
  8. 762157Domain d2a07h1: 2a07 H:506-584 [125940]
    automatically matched to 2A07 F:503-584
    complexed with mg; mutant

Details for d2a07h1

PDB Entry: 2a07 (more details), 1.9 Å

PDB Description: Crystal Structure of Foxp2 bound Specifically to DNA.
PDB Compounds: (H:) Forkhead box protein P2

SCOP Domain Sequences for d2a07h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a07h1 a.4.5.14 (H:506-584) Forkhead box protein P2, FOXP2 {Human (Homo sapiens) [TaxId: 9606]}
pftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkcfvrv
envkgavwtvdeveyqkrr

SCOP Domain Coordinates for d2a07h1:

Click to download the PDB-style file with coordinates for d2a07h1.
(The format of our PDB-style files is described here.)

Timeline for d2a07h1: