SCOP 1.75: Domain d2a07g1: 2a07 G:506-584

Lineage for d2a07g1 (2a07 G:506-584)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.14: Forkhead DNA-binding domain [46832] (6 proteins)

6. Protein Forkhead box protein P2, FOXP2 [140265] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140266] (2 PDB entries)
   Uniprot O15409 503-584

8. Domain d2a07g1: 2a07 G:506-584 [125939]
   automatically matched to 2A07 F:503-584
   complexed with mg; mutant

Details for d2a07g1

PDB Entry: 2a07, 1.9 Å

PDB Description: crystal structure of foxp2 bound specifically to dna.

PDB Compounds: (G:) Forkhead box protein P2

SCOP Domain Sequences for d2a07g1:

Sequence; same for both SEQRES and ATOM records:

>d2a07g1 a.4.5.14 (G:506-584) Forkhead box protein P2, FOXP2 {Human (Homo sapiens) [TaxId: 9606]}
pftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkcfvrv
envkgavwtvdeveyqkrr

Timeline for d2a07g1:

• d2a07g1 first appeared in SCOP 1.73
  
• d2a07g1 is called d2a07g_ in SCOPe 2.01
  
• d2a07g1 appears in the current release, SCOPe 2.08, called d2a07g_