Class a: All alpha proteins [46456] (258 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) contains a small beta-sheet (wing) |
Family a.4.5.14: Forkhead DNA-binding domain [46832] (6 proteins) |
Protein Forkhead box protein P2, FOXP2 [140265] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140266] (2 PDB entries) |
Domain d2a07g1: 2a07 G:506-584 [125939] automatically matched to 2A07 F:503-584 complexed with mg; mutant |
PDB Entry: 2a07 (more details), 1.9 Å
SCOP Domain Sequences for d2a07g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a07g1 a.4.5.14 (G:506-584) Forkhead box protein P2, FOXP2 {Human (Homo sapiens) [TaxId: 9606]} pftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkcfvrv envkgavwtvdeveyqkrr
Timeline for d2a07g1: