Lineage for d2a07f1 (2a07 F:503-584)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 635157Family a.4.5.14: Forkhead DNA-binding domain [46832] (6 proteins)
  6. 635164Protein Forkhead box protein P2, FOXP2 [140265] (1 species)
  7. 635165Species Human (Homo sapiens) [TaxId:9606] [140266] (2 PDB entries)
  8. 635166Domain d2a07f1: 2a07 F:503-584 [125938]
    complexed with mg; mutant

Details for d2a07f1

PDB Entry: 2a07 (more details), 1.9 Å

PDB Description: Crystal Structure of Foxp2 bound Specifically to DNA.
PDB Compounds: (F:) Forkhead box protein P2

SCOP Domain Sequences for d2a07f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a07f1 a.4.5.14 (F:503-584) Forkhead box protein P2, FOXP2 {Human (Homo sapiens) [TaxId: 9606]}
vrppftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkcf
vrvenvkgavwtvdeveyqkrr

SCOP Domain Coordinates for d2a07f1:

Click to download the PDB-style file with coordinates for d2a07f1.
(The format of our PDB-style files is described here.)

Timeline for d2a07f1: